MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP002668

Record overview

MGPD IDMGP002668
Gene ID6150
SpeciesHomo sapiens (Human)
Gene Namemitochondrial ribosomal protein L23
Gene Symbol MRPL23
SynonymsRPL23; L23MRP; RPL23L;
Alternate names39S ribosomal protein L23, mitochondrial; L23 mitochondrial-related protein; L23mt; MRP-L23; ribosomal protein related to L23 (mitochondrial);
Chromosome11
Map Location11p15.5
SummaryMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. The gene is biallelically expressed, despite its location within a region of imprinted genes on chromosome 11. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for MRPL23

Proteins

39S ribosomal protein L23, mitochondrial
Refseq ID:NP_066957
Protein GI:223468571
UniProt ID:Q16540
mRNA ID:NM_021134
Length:153
RefSeq Status:
MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLA
HGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL
 
  logo