MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP003492

Record overview

MGPD IDMGP003492
Gene ID8329
SpeciesHomo sapiens (Human)
Gene Namehistone cluster 1, H2ai
Gene Symbol HIST1H2AI
SynonymsH2A/c; H2AFC;
Alternate nameshistone H2A type 1; H2A histone family, member C; H2A.1; histone 1, H2ai;
Chromosome6
Map Location6p22.1
SummaryHistones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H2A family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the small histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for HIST1H2AI

Proteins

histone H2A type 1
Refseq ID:NP_003500
Protein GI:4504239
UniProt ID:P0C0S8
mRNA ID:NM_003509
Length:130
RefSeq Status:
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGK
VTIAQGGVLPNIQAVLLPKKTESHHKAKGK
 
  logo