MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP003496

Record overview

MGPD IDMGP003496
Gene ID8334
SpeciesHomo sapiens (Human)
Gene Namehistone cluster 1, H2ac
Gene Symbol HIST1H2AC
SynonymsH2A/l; H2AFL; dJ221C16.4;
Alternate nameshistone H2A type 1-C; H2A histone family, member L; histone 1, H2ac; histone H2A/l; histone H2AC;
Chromosome6
Map Location6p22.1
SummaryHistones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H2A family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for HIST1H2AC

Proteins

histone H2A type 1-C
Refseq ID:NP_003503
Protein GI:4504245
UniProt ID:Q93077
mRNA ID:NM_003512
Length:130
RefSeq Status:
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGR
VTIAQGGVLPNIQAVLLPKKTESHHKAKGK
 
  logo