MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP003511

Record overview

MGPD IDMGP003511
Gene ID8349
SpeciesHomo sapiens (Human)
Gene Namehistone cluster 2, H2be
Gene Symbol HIST2H2BE
SynonymsH2B; H2BQ; GL105; H2B.1; H2BFQ; H2BGL105;
Alternate nameshistone H2B type 2-E; H2B histone family, member Q; histone 2, H2be; histone H2B-GL105; histone H2B.q;
Chromosome1
Map Location1q21.2
SummaryHistones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a member of the histone H2B family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. The protein has antibacterial and antifungal antimicrobial activity. [provided by RefSeq, Dec 2014]
OrthologsView orthologs and multiple alignments for HIST2H2BE

Proteins

histone H2B type 2-E
Refseq ID:NP_003519
Protein GI:4504277
UniProt ID:Q16778
mRNA ID:NM_003528
Length:126
RefSeq Status:
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVR
LLLPGELAKHAVSEGTKAVTKYTSSK
 
mat_peptide: 2..21
product: histone H2B type 2-E
experiment: DESCRIPTION:antimicrobial peptide[PMID: 12860195]
calculated_mol_wt: 2020
peptide sequence: 
PEPAKSAPAPKKGSKKAVTK
 
  logo