MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP003520

Record overview

MGPD IDMGP003520
Gene ID8358
SpeciesHomo sapiens (Human)
Gene Namehistone cluster 1, H3b
Gene Symbol HIST1H3B
SynonymsH3/l; H3FL;
Alternate nameshistone H3.1; H3 histone family, member L; histone 1, H3b; histone H3/l;
Chromosome6
Map Location6p22.2
SummaryHistones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for HIST1H3B

Proteins

histone H3.1
Refseq ID:NP_003528
Protein GI:4504297
UniProt ID:P68431
mRNA ID:NM_003537
Length:136
RefSeq Status:
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
 
  logo