MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP003522

Record overview

MGPD IDMGP003522
Gene ID8360
SpeciesHomo sapiens (Human)
Gene Namehistone cluster 1, H4d
Gene Symbol HIST1H4D
SynonymsH4/b; H4FB; dJ221C16.9;
Alternate nameshistone H4; H4 histone family, member B; histone 1, H4d;
Chromosome6
Map Location6p22.2
SummaryHistones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for HIST1H4D

Proteins

histone H4
Refseq ID:NP_003530
Protein GI:4504303
UniProt ID:P62805
mRNA ID:NM_003539
Length:103
RefSeq Status:
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
FGG
 
  logo