MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP004967

Record overview

MGPD IDMGP004967
Gene ID27345
SpeciesHomo sapiens (Human)
Gene Namepotassium channel subfamily M regulatory beta subunit 4
Gene Symbol KCNMB4
Alternate namescalcium-activated potassium channel subunit beta-4; BK channel beta subunit 4; BK channel subunit beta-4; BKbeta4; MaxiK channel beta-subunit 4; big potassium channel beta subunit 4; calcium-activated potassium channel, subfamily M subunit beta-4; charybdotoxin receptor subunit beta-4; hbeta4; k(VCA)beta-4; large conductance calcium-dependent potassium ion channel beta 4 subunit; maxi K channel subunit beta-4; potassium large conductance calcium-activated channel, subfamily M, beta member 4; slo-beta-4;
Chromosome12
Map Location12q
SummaryMaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which slows activation kinetics, leads to steeper calcium sensitivity, and shifts the voltage range of current activation to more negative potentials than does the beta 1 subunit. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for KCNMB4

Proteins

calcium-activated potassium channel subunit beta-4
Refseq ID:NP_055320
Protein GI:26051275
UniProt ID:Q86W47
mRNA ID:NM_014505
Length:210
RefSeq Status:
MAKLRVAYEYTEAEDKSIRLGLFLIISGVVSLFIFGFCWLSPALQDLQATEANCTVLSVQQIGEVFECTFTCGADCRGTSQYPCVQVYVNNSESNSRALL
HSDEHQLLTNPKCSYIPPCKRENQKNLESVMNWQQYWKDEIGSQPFTCYFNQHQRPDDVLLHRTHDEIVLLHCFLWPLVTFVVGVLIVVLTICAKSLAVK
AEAMKKRKFS
 
  logo