MGP Database

MGP004978

Record overview

MGPD IDMGP004978
Gene ID28973
SpeciesHomo sapiens (Human)
Gene Namemitochondrial ribosomal protein S18B
Gene Symbol MRPS18B
SynonymsPTD017; S18amt; C6orf14; HSPC183; MRPS18-2; HumanS18a; MRP-S18-2;
Alternate names28S ribosomal protein S18b, mitochondrial; 28S ribosomal protein S18-2, mitochondrial; MRP-S18-b; S18mt-b; mitochondrial ribosomal protein S18-2; mrps18-b;
Chromosome6
Map Location6p21.3
SummaryMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S18P family. The encoded protein is one of three that has significant sequence similarity to bacterial S18 proteins. The primary sequences of the three human mitochondrial S18 proteins are no more closely related to each other than they are to the prokaryotic S18 proteins. Pseudogenes corresponding to this gene are found on chromosomes 1q and 2q. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for MRPS18B

Proteins

28S ribosomal protein S18b, mitochondrial
Refseq ID:NP_054765
Protein GI:7662645
UniProt ID:Q9Y676
mRNA ID:NM_014046
Length:258
RefSeq Status:
MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKV
VGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWY
PWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL
 
  logo