MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP006197

Record overview

MGPD IDMGP006197
Gene ID85236
SpeciesHomo sapiens (Human)
Gene Namehistone cluster 1, H2bk
Gene Symbol HIST1H2BK
SynonymsH2BK; H2B/S; H2BFT; H2BFAiii;
Alternate nameshistone H2B type 1-K; H2B K; H2B histone family, member T; HIRA-interacting protein 1; histone 1, H2bk; histone family member;
Chromosome6
Map Location6p21.33
SummaryHistones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a member of the histone H2B family. The protein encoded is an antimicrobial protein with antibacterial and antifungal activity. This gene is found in the histone microcluster on chromosome 6p21.33. [provided by RefSeq, Dec 2014]
OrthologsView orthologs and multiple alignments for HIST1H2BK

Proteins

histone H2B type 1-K
Refseq ID:NP_542160
Protein GI:18105048
UniProt ID:O60814
mRNA ID:NM_080593
Length:126
RefSeq Status:
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVR
LLLPGELAKHAVSEGTKAVTKYTSAK
 
mat_peptide: 2..21
product: histone H2B type 1-K
experiment: DESCRIPTION:antimicrobial peptide[PMID: 21178486]
calculated_mol_wt: 2020
peptide sequence: 
PEPAKSAPAPKKGSKKAVTK
 
  logo