MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP007261

Record overview

MGPD IDMGP007261
Gene ID723790
SpeciesHomo sapiens (Human)
Gene Namehistone cluster 2, H2aa4
Gene Symbol HIST2H2AA4
SynonymsH2A/R;
Alternate nameshistone H2A type 2-A; histone 2, H2aa4; histone H2A/r;
Chromosome1
Map Location1q21.2
SummaryHistones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H2A family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the telomeric copy. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for HIST2H2AA4

Proteins

histone H2A type 2-A
Refseq ID:NP_001035807
Protein GI:106775678
UniProt ID:Q6FI13
mRNA ID:NM_001040874
Length:130
RefSeq Status:
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGK
VTIAQGGVLPNIQAVLLPKKTESHHKAKGK
 
  logo