MGP Database

MGP000814

Record overview

MGPD ID	MGP000814
Gene ID	1668
Species	Homo sapiens (Human)
Gene Name	defensin, alpha 3, neutrophil-specific
Gene Symbol	DEFA3
Synonyms	HP3; DEF3; HNP3; HP-3; HNP-3;
Alternate names	neutrophil defensin 3; neutrophil peptide 3; defensin 3, neutrophil-specific;
Chromosome	8
Map Location	8p23.1
Summary	Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 3, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 1 by only one amino acid. This gene and the gene encoding defensin, alpha 1 are both subject to copy number variation. [provided by RefSeq, Oct 2014]
Orthologs	View orthologs and multiple alignments for DEFA3

Proteins

neutrophil defensin 3 preproprotein

Refseq ID:	NP_005208
Protein GI:	4885179
UniProt ID:	P59666
mRNA ID:	NM_005217
Length:	94
RefSeq Status:

`MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC`

sig_peptide: 1..19
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 1980
peptide sequence: 
MRTLAILAAILLVALQAQA

mat_peptide: 65..94
product: neutrophil defensin 3
experiment: DESCRIPTION:antimicrobial peptide[PMID: 2997278]
exception: alternative processing
calculated_mol_wt: 3492
peptide sequence: 
DCYCRIPACIAGERRYGTCIYQGRLWAFCC

mat_peptide: 66..94
product: neutrophil defensin 2
experiment: DESCRIPTION:antimicrobial peptide[PMID: 2997278]
exception: alternative processing
calculated_mol_wt: 3377
peptide sequence: 
CYCRIPACIAGERRYGTCIYQGRLWAFCC