MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP001363

Record overview

MGPD IDMGP001363
Gene ID2958
SpeciesHomo sapiens (Human)
Gene Namegeneral transcription factor IIA, 2, 12kDa
Gene Symbol GTF2A2
SynonymsTF2A2; TFIIA; HsT18745;
Alternate namestranscription initiation factor IIA subunit 2; TFIIA p12 subunit; TFIIA-12; TFIIA-gamma; TFIIAS; general transcription factor IIA subunit 2; transcription initiation factor IIA gamma chain;
Chromosome15
Map Location15q22.2
SummaryAccurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and the general initiation factors TFIIA, TFIIB (MIM 189963), TFIID (MIM 313650), TFIIE (MIM 189962), TFIIF (MIM 189968), TFIIG/TFIIJ, and TFIIH (MIM 189972). The first step involves recognition of the TATA element by the TATA-binding subunit (TBP; MIM 600075) and may be regulated by TFIIA, a factor that interacts with both TBP and a TBP-associated factor (TAF; MIM 600475) in TFIID. TFIIA has 2 subunits (43 and 12 kD) in yeast and 3 subunits in higher eukaryotes. In HeLa extracts, it consists of a 35-kD alpha subunit and a 19-kD beta subunit encoded by the N- and C-terminal regions of GTF2A1 (MIM 600520), respectively, and a 12-kD gamma subunit encoded by GTF2A2 (DeJong et al., 1995 [PubMed 7724559]).[supplied by OMIM, Mar 2008]
OrthologsView orthologs and multiple alignments for GTF2A2

Proteins

transcription initiation factor IIA subunit 2
Refseq ID:NP_004483
Protein GI:4758486
UniProt ID:P52657
mRNA ID:NM_004492
Length:109
RefSeq Status:
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDG
KNTGSNTTE
 
  logo