MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP002180

Record overview

MGPD IDMGP002180
Gene ID5020
SpeciesHomo sapiens (Human)
Gene Nameoxytocin/neurophysin I prepropeptide
Gene Symbol OXT
SynonymsOT; OT-NPI; OXT-NPI;
Alternate namesoxytocin-neurophysin 1; neurophysin I; oxytocin, prepro- (neurophysin I); oxytocin, prepropeptide; oxytocin-neurophysin I, preproprotein;
Chromosome20
Map Location20p13
SummaryThis gene encodes a precursor protein that is processed to produce oxytocin and neurophysin I. Oxytocin is a posterior pituitary hormone which is synthesized as an inactive precursor in the hypothalamus along with its carrier protein neurophysin I. Together with neurophysin, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis, where it is either stored or secreted into the bloodstream. The precursor seems to be activated while it is being transported along the axon to the posterior pituitary. This hormone contracts smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions. [provided by RefSeq, Dec 2013]
OrthologsView orthologs and multiple alignments for OXT

Proteins

oxytocin-neurophysin 1 preproprotein
Refseq ID:NP_000906
Protein GI:4505537
UniProt ID:P01178
mRNA ID:NM_000915
Length:125
RefSeq Status:
MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAV
LGLCCSPDGCHADPACDAEATFSQR
 
sig_peptide: 1..19
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 1805
peptide sequence: 
MAGPSLACCLLGLLALTSA

mat_peptide: 20..28
product: Oxytocin
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P01178.1)
calculated_mol_wt: 1010
peptide sequence: 
CYIQNCPLG

mat_peptide: 32..125
product: Neurophysin 1
experiment: experimental evidence, no additional details recorded
note: propagated from UniProtKB/Swiss-Prot (P01178.1)
calculated_mol_wt: 9601
peptide sequence: 
AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
 
  logo