MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP004951

Record overview

MGPD IDMGP004951
Gene ID27257
SpeciesHomo sapiens (Human)
Gene NameLSM1, U6 small nuclear RNA associated
Gene Symbol LSM1
SynonymsCASM; YJL124C;
Alternate namesU6 snRNA-associated Sm-like protein LSm1; LSM1 homolog, U6 small nuclear RNA associated; cancer-associated Sm-like protein; small nuclear ribonuclear CaSm;
Chromosome8
Map Location8p11.2
SummaryThis gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Increased expression of this gene may play a role in cellular transformation and the progression of several malignancies including lung cancer, mesothelioma and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. [provided by RefSeq, Nov 2011]
OrthologsView orthologs and multiple alignments for LSM1

Proteins

U6 snRNA-associated Sm-like protein LSm1
Refseq ID:NP_055277
Protein GI:7657313
UniProt ID:O15116
mRNA ID:NM_014462
Length:133
RefSeq Status:
MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQR
VEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY
 
  logo