MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP005219

Record overview

MGPD IDMGP005219
Gene ID51639
SpeciesHomo sapiens (Human)
Gene Namesplicing factor 3b, subunit 6, 14kDa
Gene Symbol SF3B6
SynonymsP14; Ht006; SAP14; SAP14a; SF3B14; CGI-110; HSPC175; SF3B14a;
Alternate namessplicing factor 3B subunit 6; SF3b 14 kDa subunit; pre mRNA branch site protein p14; pre-mRNA branch site protein p14; spliceosome-associated protein, 14 kDa subunit; spliceosome-associated protein, 14-kDa; splicing factor 3B, 14 kDa subunit;
Chromosome2
Map Location2p23
SummaryThis gene encodes a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. This 14 kDa protein also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site. [provided by RefSeq, Jul 2008]
OrthologsView orthologs and multiple alignments for SF3B6

Proteins

splicing factor 3B subunit 6
Refseq ID:NP_057131
Protein GI:7706326
UniProt ID:Q9Y3B4
mRNA ID:NM_016047
Length:125
RefSeq Status:
MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQK
MDTKKKEEQLKLLKEKYGINTDPPK
 
  logo