MGP Database

New search | Record Overview | Ontology/Pathway Information | Domain Information | UniProt Annotations | Related Proteins
MGP002784

Record overview

MGPD IDMGP002784
Gene ID6366
SpeciesHomo sapiens (Human)
Gene Namechemokine (C-C motif) ligand 21
Gene Symbol CCL21
SynonymsECL; SLC; CKb9; TCA4; 6Ckine; SCYA21;
Alternate namesC-C motif chemokine 21; Efficient Chemoattractant for Lymphocytes; beta chemokine exodus-2; secondary lymphoid tissue chemokine; small inducible cytokine subfamily A (Cys-Cys), member 21;
Chromosome9
Map Location9p13
SummaryThis antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19). [provided by RefSeq, Sep 2014]
OrthologsView orthologs and multiple alignments for CCL21

Proteins

C-C motif chemokine 21 precursor
Refseq ID:NP_002980
Protein GI:4506835
UniProt ID:O00585
mRNA ID:NM_002989
Length:134
RefSeq Status:
MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPA
QGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
 
sig_peptide: 1..23
inference: COORDINATES: ab initio prediction:SignalP:4.0
calculated_mol_wt: 2413
peptide sequence: 
MAQSLALSLLILVLAFGIPRTQG

mat_peptide: 24..134
product: C-C motif chemokine 21
experiment: DESCRIPTION:antimicrobial peptide[12949249]
calculated_mol_wt: 12251
peptide sequence: 
SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCK
RTERSQTPKGP
 
  logo